Lineage for d1kjqa3 (1kjq A:113-318)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196989Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 196990Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 197010Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 197096Protein Glycinamide ribonucleotide transformylase PurT [56074] (1 species)
  7. 197097Species Escherichia coli [TaxId:562] [56075] (7 PDB entries)
  8. 197098Domain d1kjqa3: 1kjq A:113-318 [72618]
    Other proteins in same PDB: d1kjqa1, d1kjqa2, d1kjqb1, d1kjqb2

Details for d1kjqa3

PDB Entry: 1kjq (more details), 1.05 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase in complex with Mg-ADP

SCOP Domain Sequences for d1kjqa3:

Sequence, based on SEQRES records: (download)

>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyre
swqpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtl
isqdlsefalhvraflglpvggirqy

Sequence, based on observed residues (ATOM records): (download)

>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmskgqtfirsaeqla
qawkyaqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswq
pqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisq
dlsefalhvraflglpvggirqy

SCOP Domain Coordinates for d1kjqa3:

Click to download the PDB-style file with coordinates for d1kjqa3.
(The format of our PDB-style files is described here.)

Timeline for d1kjqa3: