![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
![]() | Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52449] (7 PDB entries) |
![]() | Domain d1kjqa2: 1kjq A:2-112 [72617] Other proteins in same PDB: d1kjqa1, d1kjqa3, d1kjqb1, d1kjqb3 |
PDB Entry: 1kjq (more details), 1.05 Å
SCOP Domain Sequences for d1kjqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli} tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm
Timeline for d1kjqa2: