SCOP 1.61: Domain d1kjqa2: 1kjq A:2-112

Lineage for d1kjqa2 (1kjq A:2-112)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT [52448] (1 species)

7. Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)

8. Domain d1kjqa2: 1kjq A:2-112 [72617]
   Other proteins in same PDB: d1kjqa1, d1kjqa3, d1kjqb1, d1kjqb3

Details for d1kjqa2

PDB Entry: 1kjq, 1.05 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase in complex with Mg-ADP

SCOP Domain Sequences for d1kjqa2:

Sequence; same for both SEQRES and ATOM records:

>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

Timeline for d1kjqa2:

• d1kjqa2 is new in SCOP 1.61
  
• d1kjqa2 appears in SCOP 1.63
  
• d1kjqa2 appears in the current release, SCOPe 2.08