SCOPe 2.08: Domain d1kjqa1: 1kjq A:319-392

Lineage for d1kjqa1 (1kjq A:319-392)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species)

7. Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)

8. Domain d1kjqa1: 1kjq A:319-392 [72616]
   Other proteins in same PDB: d1kjqa2, d1kjqa3, d1kjqb2, d1kjqb3
   complexed with adp, cl, edo, mg, mpo, na

Details for d1kjqa1

PDB Entry: 1kjq, 1.05 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase in complex with Mg-ADP

PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1kjqa1:

Sequence; same for both SEQRES and ATOM records:

>d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

Timeline for d1kjqa1:

• d1kjqa1 first appeared in SCOP 1.61
  
• d1kjqa1 appears in SCOPe 2.07