Lineage for d1kjnb_ (1kjn B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2492413Fold c.115: Hypothetical protein MTH777 (MT0777) [75180] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2492414Superfamily c.115.1: Hypothetical protein MTH777 (MT0777) [75181] (1 family) (S)
    automatically mapped to Pfam PF09001
  5. 2492415Family c.115.1.1: Hypothetical protein MTH777 (MT0777) [75182] (1 protein)
  6. 2492416Protein Hypothetical protein MTH777 (MT0777) [75183] (1 species)
  7. 2492417Species Methanobacterium thermoautotrophicum [TaxId:145262] [75184] (1 PDB entry)
  8. 2492419Domain d1kjnb_: 1kjn B: [72615]
    structural genomics

Details for d1kjnb_

PDB Entry: 1kjn (more details), 2.2 Å

PDB Description: structure of mt0777
PDB Compounds: (B:) mth0777

SCOPe Domain Sequences for d1kjnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjnb_ c.115.1.1 (B:) Hypothetical protein MTH777 (MT0777) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
tgkalmvlgcpespvqiplaiytshklkkkgfrvtvtanpaalrlvqvadpegiytdemv
dlescinelaegdyeflagfvpndaaaaylvtfagilntetlaiifdrdadvleelvnei
metldaeiiaarahhnpaplrvridrfmeekp

SCOPe Domain Coordinates for d1kjnb_:

Click to download the PDB-style file with coordinates for d1kjnb_.
(The format of our PDB-style files is described here.)

Timeline for d1kjnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kjna_