Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.115: Hypothetical protein MTH777 (MT0777) [75180] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.115.1: Hypothetical protein MTH777 (MT0777) [75181] (1 family) automatically mapped to Pfam PF09001 |
Family c.115.1.1: Hypothetical protein MTH777 (MT0777) [75182] (1 protein) |
Protein Hypothetical protein MTH777 (MT0777) [75183] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [75184] (1 PDB entry) |
Domain d1kjna_: 1kjn A: [72614] structural genomics |
PDB Entry: 1kjn (more details), 2.2 Å
SCOPe Domain Sequences for d1kjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjna_ c.115.1.1 (A:) Hypothetical protein MTH777 (MT0777) {Methanobacterium thermoautotrophicum [TaxId: 145262]} tgkalmvlgcpespvqiplaiytshklkkkgfrvtvtanpaalrlvqvadpegiytdemv dlescinelaegdyeflagfvpndaaaaylvtfagilntetlaiifdrdadvleelvnei metldaeiiaarahhnpaplrvridrfmeekp
Timeline for d1kjna_: