Lineage for d1kjib2 (1kji B:2-112)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312607Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 312608Superfamily c.30.1: PreATP-grasp domain [52440] (5 families) (S)
    preceeds the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 312609Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)
  6. 312695Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species)
  7. 312696Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)
  8. 312704Domain d1kjib2: 1kji B:2-112 [72605]
    Other proteins in same PDB: d1kjia1, d1kjia3, d1kjib1, d1kjib3
    complexed with acp, cl, edo, mg, mpo, na

Details for d1kjib2

PDB Entry: 1kji (more details), 1.6 Å

PDB Description: crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp

SCOP Domain Sequences for d1kjib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjib2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

SCOP Domain Coordinates for d1kjib2:

Click to download the PDB-style file with coordinates for d1kjib2.
(The format of our PDB-style files is described here.)

Timeline for d1kjib2: