Lineage for d1kjib1 (1kji B:319-392)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234880Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 234924Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 234925Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 234937Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species)
  7. 234938Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)
  8. 234946Domain d1kjib1: 1kji B:319-392 [72604]
    Other proteins in same PDB: d1kjia2, d1kjia3, d1kjib2, d1kjib3
    complexed with acp, cl, edo, mg, mpo, na

Details for d1kjib1

PDB Entry: 1kji (more details), 1.6 Å

PDB Description: crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp

SCOP Domain Sequences for d1kjib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjib1 b.84.2.1 (B:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

SCOP Domain Coordinates for d1kjib1:

Click to download the PDB-style file with coordinates for d1kjib1.
(The format of our PDB-style files is described here.)

Timeline for d1kjib1: