SCOP 1.61: Domain d1kjfb_: 1kjf B:

Lineage for d1kjfb_ (1kjf B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (141 PDB entries)

8. Domain d1kjfb_: 1kjf B: [72596]

Details for d1kjfb_

PDB Entry: 1kjf, 2 Å

PDB Description: substrate shape determines specificity of recognition recognition for hiv-1 protease: analysis of crystal structures of six substrate complexes

SCOP Domain Sequences for d1kjfb_:

Sequence; same for both SEQRES and ATOM records:

>d1kjfb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1kjfb_:

• d1kjfb_ is new in SCOP 1.61
  
• d1kjfb_ appears in SCOP 1.63
  
• d1kjfb_ appears in the current release, SCOPe 2.08