Lineage for d1kj8b3 (1kj8 B:113-318)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978554Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2978703Protein Glycinamide ribonucleotide transformylase PurT, domain 2 [56074] (1 species)
  7. 2978704Species Escherichia coli [TaxId:562] [56075] (7 PDB entries)
  8. 2978710Domain d1kj8b3: 1kj8 B:113-318 [72588]
    Other proteins in same PDB: d1kj8a1, d1kj8a2, d1kj8b1, d1kj8b2
    complexed with atp, cl, edo, gar, mg, mpo, na

Details for d1kj8b3

PDB Entry: 1kj8 (more details), 1.6 Å

PDB Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar
PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1kj8b3:

Sequence, based on SEQRES records: (download)

>d1kj8b3 d.142.1.2 (B:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyre
swqpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtl
isqdlsefalhvraflglpvggirqy

Sequence, based on observed residues (ATOM records): (download)

>d1kj8b3 d.142.1.2 (B:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqgrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqm
splaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlse
falhvraflglpvggirqy

SCOPe Domain Coordinates for d1kj8b3:

Click to download the PDB-style file with coordinates for d1kj8b3.
(The format of our PDB-style files is described here.)

Timeline for d1kj8b3: