Lineage for d1kj8b1 (1kj8 B:319-392)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172057Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 172100Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 172101Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
  6. 172113Protein Glycinamide ribonucleotide transformylase PurT [51254] (1 species)
  7. 172114Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)
  8. 172120Domain d1kj8b1: 1kj8 B:319-392 [72586]
    Other proteins in same PDB: d1kj8a2, d1kj8a3, d1kj8b2, d1kj8b3

Details for d1kj8b1

PDB Entry: 1kj8 (more details), 1.6 Å

PDB Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar

SCOP Domain Sequences for d1kj8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj8b1 b.84.2.1 (B:319-392) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

SCOP Domain Coordinates for d1kj8b1:

Click to download the PDB-style file with coordinates for d1kj8b1.
(The format of our PDB-style files is described here.)

Timeline for d1kj8b1: