Lineage for d1kj8a3 (1kj8 A:113-318)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611545Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 611546Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 611566Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 611671Protein Glycinamide ribonucleotide transformylase PurT, domain 2 [56074] (1 species)
  7. 611672Species Escherichia coli [TaxId:562] [56075] (7 PDB entries)
  8. 611675Domain d1kj8a3: 1kj8 A:113-318 [72585]
    Other proteins in same PDB: d1kj8a1, d1kj8a2, d1kj8b1, d1kj8b2

Details for d1kj8a3

PDB Entry: 1kj8 (more details), 1.6 Å

PDB Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar

SCOP Domain Sequences for d1kj8a3:

Sequence, based on SEQRES records: (download)

>d1kj8a3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyre
swqpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtl
isqdlsefalhvraflglpvggirqy

Sequence, based on observed residues (ATOM records): (download)

>d1kj8a3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpq
qmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdl
sefalhvraflglpvggirqy

SCOP Domain Coordinates for d1kj8a3:

Click to download the PDB-style file with coordinates for d1kj8a3.
(The format of our PDB-style files is described here.)

Timeline for d1kj8a3: