SCOP 1.61: Domain d1kj8a2: 1kj8 A:2-112

Lineage for d1kj8a2 (1kj8 A:2-112)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT [52448] (1 species)

7. Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)

8. Domain d1kj8a2: 1kj8 A:2-112 [72584]
   Other proteins in same PDB: d1kj8a1, d1kj8a3, d1kj8b1, d1kj8b3

Details for d1kj8a2

PDB Entry: 1kj8, 1.6 Å

PDB Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar

SCOP Domain Sequences for d1kj8a2:

Sequence; same for both SEQRES and ATOM records:

>d1kj8a2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

Timeline for d1kj8a2:

• d1kj8a2 is new in SCOP 1.61
  
• d1kj8a2 appears in SCOP 1.63
  
• d1kj8a2 appears in the current release, SCOPe 2.08