Lineage for d1kj8a2 (1kj8 A:2-112)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178746Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 178747Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 178748Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 178834Protein Glycinamide ribonucleotide transformylase PurT [52448] (1 species)
  7. 178835Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)
  8. 178840Domain d1kj8a2: 1kj8 A:2-112 [72584]
    Other proteins in same PDB: d1kj8a1, d1kj8a3, d1kj8b1, d1kj8b3

Details for d1kj8a2

PDB Entry: 1kj8 (more details), 1.6 Å

PDB Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar

SCOP Domain Sequences for d1kj8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj8a2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

SCOP Domain Coordinates for d1kj8a2:

Click to download the PDB-style file with coordinates for d1kj8a2.
(The format of our PDB-style files is described here.)

Timeline for d1kj8a2: