Lineage for d1kj8a1 (1kj8 A:319-392)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810849Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 810850Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 810883Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species)
  7. 810884Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)
  8. 810889Domain d1kj8a1: 1kj8 A:319-392 [72583]
    Other proteins in same PDB: d1kj8a2, d1kj8a3, d1kj8b2, d1kj8b3

Details for d1kj8a1

PDB Entry: 1kj8 (more details), 1.6 Å

PDB Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase 2

SCOP Domain Sequences for d1kj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj8a1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

SCOP Domain Coordinates for d1kj8a1:

Click to download the PDB-style file with coordinates for d1kj8a1.
(The format of our PDB-style files is described here.)

Timeline for d1kj8a1: