SCOPe 2.05: Domain d1kj4a_: 1kj4 A:

Lineage for d1kj4a_ (1kj4 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1kj4a_: 1kj4 A: [72575]
   complexed with act

Details for d1kj4a_

PDB Entry: 1kj4, 2.9 Å

PDB Description: substrate shape determines specificity of recognition recognition for hiv-1 protease: analysis of crystal structures of six substrate complexes

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1kj4a_:

Sequence; same for both SEQRES and ATOM records:

>d1kj4a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1kj4a_:

• d1kj4a_ first appeared in SCOP 1.61
  
• d1kj4a_ appears in SCOPe 2.04
  
• d1kj4a_ appears in SCOPe 2.06
  
• d1kj4a_ appears in the current release, SCOPe 2.08