SCOP 1.61: Domain d1kj3m1: 1kj3 M:

Lineage for d1kj3m1 (1kj3 M:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries)

8. Domain d1kj3m1: 1kj3 M: [72574]
   Other proteins in same PDB: d1kj3h2, d1kj3i2

Details for d1kj3m1

PDB Entry: 1kj3, 2.3 Å

PDB Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide

SCOP Domain Sequences for d1kj3m1:

Sequence; same for both SEQRES and ATOM records:

>d1kj3m1 b.1.1.2 (M:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1kj3m1:

• d1kj3m1 is new in SCOP 1.61
  
• d1kj3m1 is called d1kj3m_ in SCOP 1.63
  
• d1kj3m1 appears in the current release, SCOPe 2.08, called d1kj3m_