Lineage for d1kj3l_ (1kj3 L:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364355Protein beta2-microglobulin [88600] (4 species)
  7. 364479Species Mouse (Mus musculus) [TaxId:10090] [88603] (59 PDB entries)
  8. 364510Domain d1kj3l_: 1kj3 L: [72573]
    Other proteins in same PDB: d1kj3h1, d1kj3h2, d1kj3i1, d1kj3i2

Details for d1kj3l_

PDB Entry: 1kj3 (more details), 2.3 Å

PDB Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide

SCOP Domain Sequences for d1kj3l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj3l_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1kj3l_:

Click to download the PDB-style file with coordinates for d1kj3l_.
(The format of our PDB-style files is described here.)

Timeline for d1kj3l_: