SCOP 1.61: Domain d1kj3i2: 1kj3 I:1-181

Lineage for d1kj3i2 (1kj3 I:1-181)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (22 PDB entries)

8. Domain d1kj3i2: 1kj3 I:1-181 [72572]
   Other proteins in same PDB: d1kj3h1, d1kj3i1, d1kj3l1, d1kj3m1

Details for d1kj3i2

PDB Entry: 1kj3, 2.3 Å

PDB Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide

SCOP Domain Sequences for d1kj3i2:

Sequence; same for both SEQRES and ATOM records:

>d1kj3i2 d.19.1.1 (I:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1kj3i2:

• d1kj3i2 is new in SCOP 1.61
  
• d1kj3i2 appears in SCOP 1.63
  
• d1kj3i2 appears in the current release, SCOPe 2.08