SCOPe 2.03: Domain d1kj3i1: 1kj3 I:182-278

Lineage for d1kj3i1 (1kj3 I:182-278)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
   Uniprot P01901 22-299

8. Domain d1kj3i1: 1kj3 I:182-278 [72571]
   Other proteins in same PDB: d1kj3h2, d1kj3i2, d1kj3l_, d1kj3m_

Details for d1kj3i1

PDB Entry: 1kj3, 2.3 Å

PDB Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide

PDB Compounds: (I:) h-2kb MHC class I molecule alpha chain

SCOPe Domain Sequences for d1kj3i1:

Sequence; same for both SEQRES and ATOM records:

>d1kj3i1 b.1.1.2 (I:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

Timeline for d1kj3i1:

• d1kj3i1 first appeared in SCOP 1.61
  
• d1kj3i1 appears in SCOPe 2.02
  
• d1kj3i1 appears in SCOPe 2.04
  
• d1kj3i1 appears in the current release, SCOPe 2.08