Lineage for d1kj3h2 (1kj3 H:0-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021201Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
    Uniprot P01901 22-299
  8. 1021229Domain d1kj3h2: 1kj3 H:0-181 [72570]
    Other proteins in same PDB: d1kj3h1, d1kj3i1, d1kj3l_, d1kj3m_

Details for d1kj3h2

PDB Entry: 1kj3 (more details), 2.3 Å

PDB Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide
PDB Compounds: (H:) h-2kb MHC class I molecule alpha chain

SCOPe Domain Sequences for d1kj3h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj3h2 d.19.1.1 (H:0-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
lr

SCOPe Domain Coordinates for d1kj3h2:

Click to download the PDB-style file with coordinates for d1kj3h2.
(The format of our PDB-style files is described here.)

Timeline for d1kj3h2: