SCOP 1.73: Domain d1kj3h2: 1kj3 H:0-181

Lineage for d1kj3h2 (1kj3 H:0-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)

8. Domain d1kj3h2: 1kj3 H:0-181 [72570]
   Other proteins in same PDB: d1kj3h1, d1kj3i1, d1kj3l_, d1kj3m_

Details for d1kj3h2

PDB Entry: 1kj3, 2.3 Å

PDB Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide

PDB Compounds: (H:) h-2kb MHC class I molecule alpha chain

SCOP Domain Sequences for d1kj3h2:

Sequence; same for both SEQRES and ATOM records:

>d1kj3h2 d.19.1.1 (H:0-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
lr

Timeline for d1kj3h2:

• d1kj3h2 first appeared in SCOP 1.61
  
• d1kj3h2 appears in SCOP 1.71
  
• d1kj3h2 appears in SCOP 1.75
  
• d1kj3h2 appears in the current release, SCOPe 2.08