Lineage for d1kj3h2 (1kj3 H:0-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190321Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 190425Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (22 PDB entries)
  8. 190440Domain d1kj3h2: 1kj3 H:0-181 [72570]
    Other proteins in same PDB: d1kj3h1, d1kj3i1, d1kj3l1, d1kj3m1

Details for d1kj3h2

PDB Entry: 1kj3 (more details), 2.3 Å

PDB Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide
PDB Compounds: (H:)

SCOP Domain Sequences for d1kj3h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj3h2 d.19.1.1 (H:0-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
lr

SCOP Domain Coordinates for d1kj3h2:

Click to download the PDB-style file with coordinates for d1kj3h2.
(The format of our PDB-style files is described here.)

Timeline for d1kj3h2: