| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
| Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries) |
| Domain d1kj3h1: 1kj3 H:182-278 [72569] Other proteins in same PDB: d1kj3h2, d1kj3i2 |
PDB Entry: 1kj3 (more details), 2.3 Å
SCOP Domain Sequences for d1kj3h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kj3h1 b.1.1.2 (H:182-278) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp
Timeline for d1kj3h1:
View in 3DDomains from other chains: (mouse over for more information) d1kj3i1, d1kj3i2, d1kj3l_, d1kj3m_ |