| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries) Uniprot P01901 22-299 |
| Domain d1kj3h1: 1kj3 H:182-278 [72569] Other proteins in same PDB: d1kj3h2, d1kj3h3, d1kj3i2, d1kj3l_, d1kj3m_ |
PDB Entry: 1kj3 (more details), 2.3 Å
SCOPe Domain Sequences for d1kj3h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kj3h1 b.1.1.2 (H:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp
Timeline for d1kj3h1:
View in 3DDomains from other chains: (mouse over for more information) d1kj3i1, d1kj3i2, d1kj3l_, d1kj3m_ |