SCOP 1.73: Domain d1kj2l_: 1kj2 L:

Lineage for d1kj2l_ (1kj2 L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)

8. Domain d1kj2l_: 1kj2 L: [72567]
   Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h1, d1kj2h2, d1kj2i1, d1kj2i2

Details for d1kj2l_

PDB Entry: 1kj2, 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

PDB Compounds: (L:) beta-2 microglobulin

SCOP Domain Sequences for d1kj2l_:

Sequence; same for both SEQRES and ATOM records:

>d1kj2l_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1kj2l_:

• d1kj2l_ first appeared in SCOP 1.61, called d1kj2l1
  
• d1kj2l_ appears in SCOP 1.71
  
• d1kj2l_ appears in SCOP 1.75
  
• d1kj2l_ appears in the current release, SCOPe 2.08