SCOPe 2.05: Domain d1kj2i2: 1kj2 I:1-181

Lineage for d1kj2i2 (1kj2 I:1-181)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
   Uniprot P01901 22-299

8. Domain d1kj2i2: 1kj2 I:1-181 [72566]
   Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h1, d1kj2i1, d1kj2l_, d1kj2m_
   complexed with nag

Details for d1kj2i2

PDB Entry: 1kj2, 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

PDB Compounds: (I:) Allogeneic H-2Kb MHC Class I Molecule

SCOPe Domain Sequences for d1kj2i2:

Sequence; same for both SEQRES and ATOM records:

>d1kj2i2 d.19.1.1 (I:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1kj2i2:

• d1kj2i2 first appeared in SCOP 1.61
  
• d1kj2i2 appears in SCOPe 2.04
  
• d1kj2i2 appears in SCOPe 2.06
  
• d1kj2i2 appears in the current release, SCOPe 2.08