Lineage for d1kj2i1 (1kj2 I:182-277)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358446Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2358545Domain d1kj2i1: 1kj2 I:182-277 [72565]
    Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h2, d1kj2i2, d1kj2l_, d1kj2m_
    complexed with nag

Details for d1kj2i1

PDB Entry: 1kj2 (more details), 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
PDB Compounds: (I:) Allogeneic H-2Kb MHC Class I Molecule

SCOPe Domain Sequences for d1kj2i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj2i1 b.1.1.2 (I:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwepp

SCOPe Domain Coordinates for d1kj2i1:

Click to download the PDB-style file with coordinates for d1kj2i1.
(The format of our PDB-style files is described here.)

Timeline for d1kj2i1: