Lineage for d1kj2h1 (1kj2 H:182-276)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220647Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)
  8. 220690Domain d1kj2h1: 1kj2 H:182-276 [72563]
    Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h2, d1kj2i2

Details for d1kj2h1

PDB Entry: 1kj2 (more details), 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1kj2h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj2h1 b.1.1.2 (H:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwep

SCOP Domain Coordinates for d1kj2h1:

Click to download the PDB-style file with coordinates for d1kj2h1.
(The format of our PDB-style files is described here.)

Timeline for d1kj2h1: