Lineage for d1kj2d_ (1kj2 D:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein T-cell antigen receptor [48933] (6 species) 
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (14 PDB entries) 
Domain d1kj2d_: 1kj2 D: [72561]
Other proteins in same PDB: d1kj2h1, d1kj2h2, d1kj2i1, d1kj2i2, d1kj2l1, d1kj2m1
Details for d1kj2d_
PDB Entry: 1kj2 (more details), 2.71 Å
PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
SCOP Domain Sequences for d1kj2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kj2d_ b.1.1.1 (D:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvsp
SCOP Domain Coordinates for d1kj2d_:
Click to download the PDB-style file with coordinates for d1kj2d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kj2d_:
- d1kj2d_ is new in SCOP 1.61
- d1kj2d_ appears in SCOP 1.63
- d1kj2d_ appears in the current release, SCOPe 2.08
View in 3D
