Lineage for d1kj2b_ (1kj2 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354864Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2355009Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 2355028Domain d1kj2b_: 1kj2 B: [72560]
    Other proteins in same PDB: d1kj2h1, d1kj2h2, d1kj2i1, d1kj2i2, d1kj2l_, d1kj2m_
    complexed with nag

Details for d1kj2b_

PDB Entry: 1kj2 (more details), 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
PDB Compounds: (B:) KB5-C20 T-Cell receptor beta-chain

SCOPe Domain Sequences for d1kj2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj2b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl

SCOPe Domain Coordinates for d1kj2b_:

Click to download the PDB-style file with coordinates for d1kj2b_.
(The format of our PDB-style files is described here.)

Timeline for d1kj2b_: