Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries) |
Domain d1kj2a_: 1kj2 A: [72559] Other proteins in same PDB: d1kj2h1, d1kj2h2, d1kj2i1, d1kj2i2, d1kj2l_, d1kj2m_ complexed with nag |
PDB Entry: 1kj2 (more details), 2.71 Å
SCOPe Domain Sequences for d1kj2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kj2a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvsp
Timeline for d1kj2a_: