Class a: All alpha proteins [46456] (226 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (5 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.5: Trichodiene synthase [69113] (1 protein) |
Protein Trichodiene synthase [69114] (1 species) |
Species Fusarium sporotrichioides [TaxId:5514] [69115] (4 PDB entries) |
Domain d1kizb_: 1kiz B: [72558] complexed with edo, mg, pop; mutant |
PDB Entry: 1kiz (more details), 2.6 Å
SCOP Domain Sequences for d1kizb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kizb_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides} menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv
Timeline for d1kizb_: