SCOP 1.71: Domain d1kizb_: 1kiz B:

Lineage for d1kizb_ (1kiz B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (5 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)

6. Protein Trichodiene synthase [69114] (1 species)

7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (4 PDB entries)

8. Domain d1kizb_: 1kiz B: [72558]
   complexed with edo, mg, pop; mutant

Details for d1kizb_

PDB Entry: 1kiz, 2.6 Å

PDB Description: d100e trichodiene synthase complexed with pyrophosphate

SCOP Domain Sequences for d1kizb_:

Sequence; same for both SEQRES and ATOM records:

>d1kizb_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

Timeline for d1kizb_:

• d1kizb_ first appeared in SCOP 1.61
  
• d1kizb_ appears in SCOP 1.69
  
• d1kizb_ appears in SCOP 1.73
  
• d1kizb_ appears in the current release, SCOPe 2.08