![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (2 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (5 proteins) |
![]() | Protein Periplasmic chaperone FimC [49358] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49359] (6 PDB entries) |
![]() | Domain d1kiuo1: 1kiu O:1-121 [72551] Other proteins in same PDB: d1kiua2, d1kiub1, d1kiub2, d1kiuc2, d1kiud1, d1kiud2, d1kiue2, d1kiuf1, d1kiuf2, d1kiug2, d1kiuh1, d1kiuh2, d1kiui2, d1kiuj1, d1kiuj2, d1kiuk2, d1kiul1, d1kiul2, d1kium2, d1kiun1, d1kiun2, d1kiuo2, d1kiup1, d1kiup2 complexed with mma; mutant |
PDB Entry: 1kiu (more details), 3 Å
SCOP Domain Sequences for d1kiuo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kiuo1 b.1.11.1 (O:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl a
Timeline for d1kiuo1:
![]() Domains from other chains: (mouse over for more information) d1kiua1, d1kiua2, d1kiub1, d1kiub2, d1kiuc1, d1kiuc2, d1kiud1, d1kiud2, d1kiue1, d1kiue2, d1kiuf1, d1kiuf2, d1kiug1, d1kiug2, d1kiuh1, d1kiuh2, d1kiui1, d1kiui2, d1kiuj1, d1kiuj2, d1kiuk1, d1kiuk2, d1kiul1, d1kiul2, d1kium1, d1kium2, d1kiun1, d1kiun2, d1kiup1, d1kiup2 |