Lineage for d1kiui1 (1kiu I:1-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299054Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 1299055Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 1299073Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 1299074Species Escherichia coli [TaxId:562] [49359] (8 PDB entries)
  8. 1299101Domain d1kiui1: 1kiu I:1-121 [72539]
    Other proteins in same PDB: d1kiua2, d1kiub1, d1kiub2, d1kiuc2, d1kiud1, d1kiud2, d1kiue2, d1kiuf1, d1kiuf2, d1kiug2, d1kiuh1, d1kiuh2, d1kiui2, d1kiuj1, d1kiuj2, d1kiuk2, d1kiul1, d1kiul2, d1kium2, d1kiun1, d1kiun2, d1kiuo2, d1kiup1, d1kiup2
    complexed with mma; mutant

Details for d1kiui1

PDB Entry: 1kiu (more details), 3 Å

PDB Description: fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d- mannose
PDB Compounds: (I:) chaperone protein fimc

SCOPe Domain Sequences for d1kiui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kiui1 b.1.11.1 (I:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOPe Domain Coordinates for d1kiui1:

Click to download the PDB-style file with coordinates for d1kiui1.
(The format of our PDB-style files is described here.)

Timeline for d1kiui1: