![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
![]() | Protein Periplasmic chaperone FimC [49358] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49359] (8 PDB entries) |
![]() | Domain d1kiui1: 1kiu I:1-121 [72539] Other proteins in same PDB: d1kiua2, d1kiub1, d1kiub2, d1kiuc2, d1kiud1, d1kiud2, d1kiue2, d1kiuf1, d1kiuf2, d1kiug2, d1kiuh1, d1kiuh2, d1kiui2, d1kiuj1, d1kiuj2, d1kiuk2, d1kiul1, d1kiul2, d1kium2, d1kiun1, d1kiun2, d1kiuo2, d1kiup1, d1kiup2 complexed with mma; mutant |
PDB Entry: 1kiu (more details), 3 Å
SCOPe Domain Sequences for d1kiui1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kiui1 b.1.11.1 (I:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl a
Timeline for d1kiui1:
![]() Domains from other chains: (mouse over for more information) d1kiua1, d1kiua2, d1kiub1, d1kiub2, d1kiuc1, d1kiuc2, d1kiud1, d1kiud2, d1kiue1, d1kiue2, d1kiuf1, d1kiuf2, d1kiug1, d1kiug2, d1kiuh1, d1kiuh2, d1kiuj1, d1kiuj2, d1kiuk1, d1kiuk2, d1kiul1, d1kiul2, d1kium1, d1kium2, d1kiun1, d1kiun2, d1kiuo1, d1kiuo2, d1kiup1, d1kiup2 |