SCOPe 2.03: Domain d1kiue2: 1kiu E:122-205

Lineage for d1kiue2 (1kiu E:122-205)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein FimC [49588] (1 species)

7. Species Escherichia coli [TaxId:562] [49589] (8 PDB entries)

8. Domain d1kiue2: 1kiu E:122-205 [72532]
   Other proteins in same PDB: d1kiua1, d1kiub1, d1kiub2, d1kiuc1, d1kiud1, d1kiud2, d1kiue1, d1kiuf1, d1kiuf2, d1kiug1, d1kiuh1, d1kiuh2, d1kiui1, d1kiuj1, d1kiuj2, d1kiuk1, d1kiul1, d1kiul2, d1kium1, d1kiun1, d1kiun2, d1kiuo1, d1kiup1, d1kiup2
   complexed with mma; mutant

Details for d1kiue2

PDB Entry: 1kiu, 3 Å

PDB Description: fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d- mannose

PDB Compounds: (E:) chaperone protein fimc

SCOPe Domain Sequences for d1kiue2:

Sequence; same for both SEQRES and ATOM records:

>d1kiue2 b.7.2.1 (E:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

Timeline for d1kiue2:

• d1kiue2 first appeared in SCOP 1.61
  
• d1kiue2 appears in SCOPe 2.02
  
• d1kiue2 appears in SCOPe 2.04
  
• d1kiue2 appears in the current release, SCOPe 2.08