Lineage for d1kiuc1 (1kiu C:1-121)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161647Superfamily b.1.11: PapD-like [49354] (2 families) (S)
  5. 161648Family b.1.11.1: Pilus chaperone [49355] (3 proteins)
  6. 161649Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 161650Species Escherichia coli [TaxId:562] [49359] (4 PDB entries)
  8. 161668Domain d1kiuc1: 1kiu C:1-121 [72527]
    Other proteins in same PDB: d1kiua2, d1kiub1, d1kiub2, d1kiuc2, d1kiud1, d1kiud2, d1kiue2, d1kiuf1, d1kiuf2, d1kiug2, d1kiuh1, d1kiuh2, d1kiui2, d1kiuj1, d1kiuj2, d1kiuk2, d1kiul1, d1kiul2, d1kium2, d1kiun1, d1kiun2, d1kiuo2, d1kiup1, d1kiup2

Details for d1kiuc1

PDB Entry: 1kiu (more details), 3 Å

PDB Description: FimH adhesin Q133N mutant-FimC chaperone complex with methyl-alpha-D-mannose
PDB Compounds: (C:)

SCOP Domain Sequences for d1kiuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kiuc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOP Domain Coordinates for d1kiuc1:

Click to download the PDB-style file with coordinates for d1kiuc1.
(The format of our PDB-style files is described here.)

Timeline for d1kiuc1: