Lineage for d1kijb2 (1kij B:9-220)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973765Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2973766Protein DNA gyrase B [55880] (2 species)
  7. 2973772Species Thermus thermophilus [TaxId:274] [75534] (1 PDB entry)
  8. 2973774Domain d1kijb2: 1kij B:9-220 [72517]
    Other proteins in same PDB: d1kija1, d1kijb1
    complexed with fmt, nov

Details for d1kijb2

PDB Entry: 1kij (more details), 2.3 Å

PDB Description: crystal structure of the 43k atpase domain of thermus thermophilus gyrase b in complex with novobiocin
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d1kijb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kijb2 d.122.1.2 (B:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]}
airvlkglegvrhrpamyiggtgvegyhhlfkeildnavdealagyateilvrlnedgsl
tvedngrgipvdlmpeegkpaveviyntlhsggkfeqgaykvsgglhgvgasvvnalsew
tvvevfregkhhriafsrgevteplrvvgeaprgktgtrvtfkpdpeifgnlrfdpskir
arlrevaylvaglklvfqdrqhgkeevfldkg

SCOPe Domain Coordinates for d1kijb2:

Click to download the PDB-style file with coordinates for d1kijb2.
(The format of our PDB-style files is described here.)

Timeline for d1kijb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kijb1