Lineage for d1kijb1 (1kij B:221-392)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537433Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 2537434Protein DNA gyrase B [54227] (2 species)
  7. 2537438Species Thermus thermophilus [TaxId:274] [75352] (1 PDB entry)
  8. 2537440Domain d1kijb1: 1kij B:221-392 [72516]
    Other proteins in same PDB: d1kija2, d1kijb2
    complexed with fmt, nov

Details for d1kijb1

PDB Entry: 1kij (more details), 2.3 Å

PDB Description: crystal structure of the 43k atpase domain of thermus thermophilus gyrase b in complex with novobiocin
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d1kijb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kijb1 d.14.1.3 (B:221-392) DNA gyrase B {Thermus thermophilus [TaxId: 274]}
gvasfakalaegedllyekpflirgthgevevevgflhtqgynaeiltyanmiptrdggt
hltafksaysralnqyakkaglnkekgpqptgddlleglyavvsvklpnpqfegqtkgkl
lnpeagtavgqvvyerlleileenpriakavyekalraaqareaarkarelv

SCOPe Domain Coordinates for d1kijb1:

Click to download the PDB-style file with coordinates for d1kijb1.
(The format of our PDB-style files is described here.)

Timeline for d1kijb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kijb2