Lineage for d1kija2 (1kij A:9-220)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196211Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
  4. 196212Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 196228Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (3 proteins)
  6. 196229Protein DNA gyrase B [55880] (2 species)
  7. 196235Species Thermus thermophilus [TaxId:274] [75534] (1 PDB entry)
  8. 196236Domain d1kija2: 1kij A:9-220 [72515]
    Other proteins in same PDB: d1kija1, d1kijb1

Details for d1kija2

PDB Entry: 1kij (more details), 2.3 Å

PDB Description: crystal structure of the 43k atpase domain of thermus thermophilus gyrase b in complex with novobiocin

SCOP Domain Sequences for d1kija2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus}
airvlkglegvrhrpamyiggtgvegyhhlfkeildnavdealagyateilvrlnedgsl
tvedngrgipvdlmpeegkpaveviyntlhsggkfeqgaykvsgglhgvgasvvnalsew
tvvevfregkhhriafsrgevteplrvvgeaprgktgtrvtfkpdpeifgnlrfdpskir
arlrevaylvaglklvfqdrqhgkeevfldkg

SCOP Domain Coordinates for d1kija2:

Click to download the PDB-style file with coordinates for d1kija2.
(The format of our PDB-style files is described here.)

Timeline for d1kija2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kija1