Lineage for d1kicb_ (1kic B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2477429Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2477430Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2477431Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2477432Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)
  7. 2477433Species Trypanosoma vivax [TaxId:5699] [69588] (5 PDB entries)
  8. 2477435Domain d1kicb_: 1kic B: [72511]
    Other proteins in same PDB: d1kica2
    complexed with ca, ni, nos; mutant

Details for d1kicb_

PDB Entry: 1kic (more details), 1.6 Å

PDB Description: inosine-adenosine-guanosine preferring nucleoside hydrolase from trypanosoma vivax: asp10ala mutant in complex with inosine
PDB Compounds: (B:) inosine-adenosine-guanosine preferring nucleoside hydrolase

SCOPe Domain Sequences for d1kicb_:

Sequence, based on SEQRES records: (download)

>d1kicb_ c.70.1.1 (B:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
aknvvldhagnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen
ypltfvarnpeaeffldmllrsarac

Sequence, based on observed residues (ATOM records): (download)

>d1kicb_ c.70.1.1 (B:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
aknvvldhagnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpea
effldmllrsarac

SCOPe Domain Coordinates for d1kicb_:

Click to download the PDB-style file with coordinates for d1kicb_.
(The format of our PDB-style files is described here.)

Timeline for d1kicb_: