Lineage for d1kibh_ (1kib H:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760781Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)
  7. 760782Species Arthrospira maxima [TaxId:129910] [63457] (2 PDB entries)
  8. 760791Domain d1kibh_: 1kib H: [72509]
    complexed with hem

Details for d1kibh_

PDB Entry: 1kib (more details), 3.5 Å

PDB Description: cytochrome c6 from arthrospira maxima: an assembly of 24 subunits in the form of an oblate shell
PDB Compounds: (H:) cytochrome c6

SCOP Domain Sequences for d1kibh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kibh_ a.3.1.1 (H:) Cytochrome c6 (synonym: cytochrome c553) {Arthrospira maxima [TaxId: 129910]}
gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
ampgfngrlspkqiedvaayvvdqaekgw

SCOP Domain Coordinates for d1kibh_:

Click to download the PDB-style file with coordinates for d1kibh_.
(The format of our PDB-style files is described here.)

Timeline for d1kibh_: