Lineage for d1kibc_ (1kib C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149462Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 149557Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species)
  7. 149558Species Arthrospira maxima [TaxId:129910] [63457] (2 PDB entries)
  8. 149562Domain d1kibc_: 1kib C: [72504]

Details for d1kibc_

PDB Entry: 1kib (more details), 3.5 Å

PDB Description: cytochrome c6 from Arthrospira maxima: an assembly of 24 subunits in the form of an oblate shell

SCOP Domain Sequences for d1kibc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kibc_ a.3.1.1 (C:) Cytochrome c6 (synonym: cytochrome c553) {Arthrospira maxima}
gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
ampgfngrlspkqiedvaayvvdqaekgw

SCOP Domain Coordinates for d1kibc_:

Click to download the PDB-style file with coordinates for d1kibc_.
(The format of our PDB-style files is described here.)

Timeline for d1kibc_: