Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein GEF of intersectin [74991] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74992] (1 PDB entry) |
Domain d1ki1d2: 1ki1 D:1439-1580 [72501] Other proteins in same PDB: d1ki1a_, d1ki1b1, d1ki1c_, d1ki1d1 complexed with so4 |
PDB Entry: 1ki1 (more details), 2.3 Å
SCOPe Domain Sequences for d1ki1d2:
Sequence, based on SEQRES records: (download)
>d1ki1d2 b.55.1.1 (D:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} hvqceglseqlvfnsvtnclgprkflhsgklykaknnkelygflfndfllltqitkplgs sgtdkvfspksnlqymyktpiflnevlvklptdpsgdepifhishidrvytlraesiner tawvqkikaaselyietekkkr
>d1ki1d2 b.55.1.1 (D:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} hvqceglseqlvfnsvtnclgprkflhsgklykaknnkelygflfndfllltqitkpkvf spksnlqymyktpiflnevlvklptdpsgdfhishidrvytlraesinertawvqkikaa selyietekkkr
Timeline for d1ki1d2:
View in 3D Domains from other chains: (mouse over for more information) d1ki1a_, d1ki1b1, d1ki1b2, d1ki1c_ |