SCOPe 2.06: Domain d1ki1c_: 1ki1 C:

Lineage for d1ki1c_ (1ki1 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (30 PDB entries)

8. Domain d1ki1c_: 1ki1 C: [72499]
   Other proteins in same PDB: d1ki1b1, d1ki1b2, d1ki1d1, d1ki1d2
   complexed with so4

Details for d1ki1c_

PDB Entry: 1ki1, 2.3 Å

PDB Description: guanine nucleotide exchange region of intersectin in complex with cdc42

PDB Compounds: (C:) G25K GTP-binding protein, placental isoform

SCOPe Domain Sequences for d1ki1c_:

Sequence; same for both SEQRES and ATOM records:

>d1ki1c_ c.37.1.8 (C:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

Timeline for d1ki1c_:

• d1ki1c_ first appeared in SCOP 1.61
  
• d1ki1c_ appears in SCOPe 2.05
  
• d1ki1c_ appears in SCOPe 2.07
  
• d1ki1c_ appears in the current release, SCOPe 2.08