Lineage for d1ki1c_ (1ki1 C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 393794Protein CDC42 [52619] (1 species)
  7. 393795Species Human (Homo sapiens) [TaxId:9606] [52620] (16 PDB entries)
  8. 393805Domain d1ki1c_: 1ki1 C: [72499]
    Other proteins in same PDB: d1ki1b1, d1ki1b2, d1ki1d1, d1ki1d2
    complexed with so4; mutant

Details for d1ki1c_

PDB Entry: 1ki1 (more details), 2.3 Å

PDB Description: guanine nucleotide exchange region of intersectin in complex with cdc42

SCOP Domain Sequences for d1ki1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ki1c_ c.37.1.8 (C:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

SCOP Domain Coordinates for d1ki1c_:

Click to download the PDB-style file with coordinates for d1ki1c_.
(The format of our PDB-style files is described here.)

Timeline for d1ki1c_: