![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.55: PH domain-like [50728] (1 superfamily) |
![]() | Superfamily b.55.1: PH domain-like [50729] (5 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (14 proteins) |
![]() | Protein GEF of intersectin [74991] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74992] (1 PDB entry) |
![]() | Domain d1ki1b2: 1ki1 B:1439-1580 [72498] Other proteins in same PDB: d1ki1a_, d1ki1b1, d1ki1c_, d1ki1d1 |
PDB Entry: 1ki1 (more details), 2.3 Å
SCOP Domain Sequences for d1ki1b2:
Sequence, based on SEQRES records: (download)
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens)} hvqceglseqlvfnsvtnclgprkflhsgklykaknnkelygflfndfllltqitkplgs sgtdkvfspksnlqymyktpiflnevlvklptdpsgdepifhishidrvytlraesiner tawvqkikaaselyietekkkr
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens)} hvqceglseqlvfnsvtnclgprkflhsgklykaknnkelygflfndfllltqitkpkvf spksnlqymyktpiflnevlvklptdpsgdfhishidrvytlraesinertawvqkikaa selyietekkkr
Timeline for d1ki1b2:
![]() Domains from other chains: (mouse over for more information) d1ki1a_, d1ki1c_, d1ki1d1, d1ki1d2 |