Lineage for d1ki1b2 (1ki1 B:1439-1580)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803180Protein GEF of intersectin [74991] (1 species)
  7. 2803181Species Human (Homo sapiens) [TaxId:9606] [74992] (1 PDB entry)
  8. 2803182Domain d1ki1b2: 1ki1 B:1439-1580 [72498]
    Other proteins in same PDB: d1ki1a_, d1ki1b1, d1ki1c_, d1ki1d1
    complexed with so4

Details for d1ki1b2

PDB Entry: 1ki1 (more details), 2.3 Å

PDB Description: guanine nucleotide exchange region of intersectin in complex with cdc42
PDB Compounds: (B:) intersectin long form

SCOPe Domain Sequences for d1ki1b2:

Sequence, based on SEQRES records: (download)

>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]}
hvqceglseqlvfnsvtnclgprkflhsgklykaknnkelygflfndfllltqitkplgs
sgtdkvfspksnlqymyktpiflnevlvklptdpsgdepifhishidrvytlraesiner
tawvqkikaaselyietekkkr

Sequence, based on observed residues (ATOM records): (download)

>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]}
hvqceglseqlvfnsvtnclgprkflhsgklykaknnkelygflfndfllltqitkpkvf
spksnlqymyktpiflnevlvklptdpsgdfhishidrvytlraesinertawvqkikaa
selyietekkkr

SCOPe Domain Coordinates for d1ki1b2:

Click to download the PDB-style file with coordinates for d1ki1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ki1b2: