Lineage for d1ki1a_ (1ki1 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein CDC42 [52619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52620] (14 PDB entries) 
Domain d1ki1a_: 1ki1 A: [72496]
Other proteins in same PDB: d1ki1b1, d1ki1b2, d1ki1d1, d1ki1d2
Details for d1ki1a_
PDB Entry: 1ki1 (more details), 2.3 Å
PDB Description: guanine nucleotide exchange region of intersectin in complex with cdc42
SCOP Domain Sequences for d1ki1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ki1a_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
SCOP Domain Coordinates for d1ki1a_:
Click to download the PDB-style file with coordinates for d1ki1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ki1a_:
- d1ki1a_ is new in SCOP 1.61
- d1ki1a_ appears in SCOP 1.63
- d1ki1a_ appears in the current release, SCOPe 2.08
View in 3D
