| Class g: Small proteins [56992] (79 folds) |
| Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) ![]() |
| Family g.14.1.1: Kringle modules [57441] (6 proteins) |
| Protein Plasminogen [63400] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries) |
| Domain d1ki0a3: 1ki0 A:251-333 [72495] Angiostatin: the N-terminal fragment containing three kringles complexed with bcn; mutant |
PDB Entry: 1ki0 (more details), 1.75 Å
SCOP Domain Sequences for d1ki0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ki0a3 g.14.1.1 (A:251-333) Plasminogen {Human (Homo sapiens)}
gptyqclkgtgenyrgnvavtvsghtcqhwsaqtphthertpenfpcknldenycrnpdg
krapwchttnsqvrweyckipsc
Timeline for d1ki0a3: