Lineage for d1ki0a3 (1ki0 A:251-333)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623175Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 623176Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 623177Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 623214Protein Plasminogen [63400] (1 species)
  7. 623215Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)
  8. 623224Domain d1ki0a3: 1ki0 A:251-333 [72495]
    Angiostatin: the N-terminal fragment containing three kringles
    complexed with bcn; mutant

Details for d1ki0a3

PDB Entry: 1ki0 (more details), 1.75 Å

PDB Description: the x-ray structure of human angiostatin

SCOP Domain Sequences for d1ki0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ki0a3 g.14.1.1 (A:251-333) Plasminogen {Human (Homo sapiens)}
gptyqclkgtgenyrgnvavtvsghtcqhwsaqtphthertpenfpcknldenycrnpdg
krapwchttnsqvrweyckipsc

SCOP Domain Coordinates for d1ki0a3:

Click to download the PDB-style file with coordinates for d1ki0a3.
(The format of our PDB-style files is described here.)

Timeline for d1ki0a3: