Lineage for d1ki0a1 (1ki0 A:81-163)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203830Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 203831Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 203832Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 203869Protein Plasminogen [63400] (1 species)
  7. 203870Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)
  8. 203875Domain d1ki0a1: 1ki0 A:81-163 [72493]

Details for d1ki0a1

PDB Entry: 1ki0 (more details), 1.75 Å

PDB Description: the x-ray structure of human angiostatin

SCOP Domain Sequences for d1ki0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ki0a1 g.14.1.1 (A:81-163) Plasminogen {Human (Homo sapiens)}
lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp
qgpwcyttdpekrydycdilece

SCOP Domain Coordinates for d1ki0a1:

Click to download the PDB-style file with coordinates for d1ki0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ki0a1: